Recombinant Full Length Human PSMA7 Protein, C-Flag-tagged
Cat.No. : | PSMA7-1369HFL |
Product Overview : | Recombinant Full Length Human PSMA7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the peptidase T1A family that functions as a 20S core alpha subunit. The encoded protein interacts with the hepatitis B virus X protein and plays a role in regulating hepatitis C virus internal ribosome entry site (IRES) activity, an activity essential for viral replication. The encoded protein also plays a role in the cellular stress response by regulating hypoxia-inducible factor-1alpha. A pseudogene of this gene is located on the long arm of chromosome 9. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 27.7 kDa |
AA Sequence : | MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVC MAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDG TPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAV MRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKASTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Protein Pathways : | Proteasome |
Full Length : | Full L. |
Gene Name | PSMA7 proteasome 20S subunit alpha 7 [ Homo sapiens (human) ] |
Official Symbol | PSMA7 |
Synonyms | C6; HSPC; RC6-1; XAPC7; HEL-S-276 |
Gene ID | 5688 |
mRNA Refseq | NM_002792.4 |
Protein Refseq | NP_002783.1 |
MIM | 606607 |
UniProt ID | O14818 |
◆ Recombinant Proteins | ||
PSMA7-415H | Recombinant Human PSMA7 Protein, His-tagged | +Inquiry |
PSMA7-1369HFL | Recombinant Full Length Human PSMA7 Protein, C-Flag-tagged | +Inquiry |
PSMA7-5162H | Recombinant Human PSMA7 protein, GST-tagged | +Inquiry |
PSMA7-2014H | Recombinant Human PSMA7 protein, GST-tagged | +Inquiry |
PSMA7-6181C | Recombinant Chicken PSMA7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMA7-2776HCL | Recombinant Human PSMA7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSMA7 Products
Required fields are marked with *
My Review for All PSMA7 Products
Required fields are marked with *
0
Inquiry Basket