Recombinant Human PSG6, His-tagged

Cat.No. : PSG6-182H
Product Overview : Recombinant Human Pregnancy-Specific β-1-Glycoprotein 6/PSG6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln35-His424) of Human PSG6 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 35-424 a.a.
Description : Pregnancy-Specific β-1-Glycoprotein 6 (PSG6) belongs to the immunoglobulin superfamily. PSG6 is a secreted protein that includes a 34 amino acid leader peptide and a 108 amino acid N domain. PSG6 contains one Ig-like V-type (immunoglobulin-like) domain and three Ig-like C2-type (immunoglobulin-like) domains. PSG6 is produced in high quantities during pregnancy. The N-terminal domain of PSG6 is sufficient for the induction of monocyte cytokine secretion.
AA Sequence : QVIIEAKPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRET VYSNASLLIQNVTQEDAGSYTLHIIKRGDGTGGVTGYFTVTLYSETPKPSISSSNLNPREVMEAV RLICDPETPDASYLWLLNGQNLPMTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDP VTLNLLPKLPMPYITINNLNPREKKDVLAFTCEPKSRNYTYIWWLNGQSLPVSPRVKRPIENRIL ILPSVTRNETGPYQCEIRDRYGGIRSNPVTLNVLYGPDLPRIYPSFTYYRSGENLDLSCFADSNP PAEYSWTINGKFQLSGQKLFIPQITTNHSGLYACSVRNSATGKEISKSMIVKVSGPCHGNQTESH VDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name PSG6 pregnancy specific beta-1-glycoprotein 6 [ Homo sapiens ]
Official Symbol PSG6
Synonyms PSG6; pregnancy specific beta-1-glycoprotein 6; pregnancy-specific beta-1-glycoprotein 6; PS-beta-G-6; PS-beta-G-10; PS-beta-G-12; pregnancy-specific beta-1-glycoprotein 10; pregnancy-specific beta-1-glycoprotein 12; PSG10; PSBG-6; PSBG-10; PSBG-12;
Gene ID 5675
mRNA Refseq NM_001031850
Protein Refseq NP_001027020
MIM 176395
UniProt ID Q00889
Chromosome Location 19q13.2
Function molecular_function;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PSG6 Products

Required fields are marked with *

My Review for All PSG6 Products

Required fields are marked with *

0

Inquiry Basket

There is no product in the inquiry basket.

cartIcon