Recombinant Human PSCA protein, His&His-tagged

• Cat.No.: PSCA-3379H
• Product Overview: Recombinant Human PSCA protein(O43653)(13-86aa), fused to N-terminal His tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 13-86aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 13.4 kDa
• AA Sequence: LCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PSCA prostate stem cell antigen [ Homo sapiens ]
• Official Symbol: PSCA
• Synonyms: PSCA; prostate stem cell antigen; PRO232
• Gene ID: 8000
• mRNA Refseq: NM_005672
• Protein Refseq: NP_005663
• MIM: 602470
• UniProt ID: O43653