Recombinant Human PSCA protein, His&His-tagged
Cat.No. : | PSCA-3379H |
Product Overview : | Recombinant Human PSCA protein(O43653)(13-86aa), fused to N-terminal His tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 13-86aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 13.4 kDa |
AA Sequence : | LCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PSCA prostate stem cell antigen [ Homo sapiens ] |
Official Symbol | PSCA |
Synonyms | PSCA; prostate stem cell antigen; PRO232; |
Gene ID | 8000 |
mRNA Refseq | NM_005672 |
Protein Refseq | NP_005663 |
MIM | 602470 |
UniProt ID | O43653 |
◆ Recombinant Proteins | ||
PSCA-03H | Recombinant Human prostate stem cell antigen Protein, Fc tagged, Biotinylated | +Inquiry |
PSCA-5744H | Recombinant Human PSCA protein, hFc-tagged | +Inquiry |
PSCA-0629M | Recombinant Mouse PSCA protein(Met1-Asn95), His&Avi-tagged, Biotinylated | +Inquiry |
PSCA-2002H | Recombinant Human PSCA protein, His-tagged | +Inquiry |
PSCA-01HP | Recombinant Human PSCA Protein, C-His-tagged, PE-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSCA-2791HCL | Recombinant Human PSCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSCA Products
Required fields are marked with *
My Review for All PSCA Products
Required fields are marked with *
0
Inquiry Basket