Recombinant Human prostate stem cell antigen Protein, Fc tagged, Biotinylated

• Cat.No.: PSCA-03H
• Product Overview: The recombinant human PSCA-Fc is expressed as a 312-amino acid protein consisting of Leu21-Ser95 region (Extracellular Domain) of PSCA (UniProt accession #O43653) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 21-95aa
• Description: This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals; this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants.
• Tag: C-Fc
• Conjugation/Label: Biotin
• Molecular Mass: 34.8 kDa
• AA Sequence: LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: < 0.1 EU/μg by LAL
• Purity: > 95% by SDS-PAGE
• Calculated PI: 6.02
• Calculated Extinction Coefficient (M-1 cm-1, at 280nm): 47870
• Storage Buffer: Sterile PBS pH7.4 (carrier and preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
• Concentration: 0.5 mg/mL

Gene Information

• Gene Name: PSCA prostate stem cell antigen [ Homo sapiens (human) ]
• Official Symbol: PSCA
• Synonyms: PSCA; prostate stem cell antigen; PRO232; lncPSCA
• Gene ID: 8000
• mRNA Refseq: NM_005672
• Protein Refseq: NP_005663
• MIM: 602470
• UniProt ID: O43653