Recombinant Human prostate stem cell antigen Protein, Fc tagged, Biotinylated
Cat.No. : | PSCA-03H |
Product Overview : | The recombinant human PSCA-Fc is expressed as a 312-amino acid protein consisting of Leu21-Ser95 region (Extracellular Domain) of PSCA (UniProt accession #O43653) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 21-95aa |
Description : | This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals; this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants. |
Tag : | C-Fc |
Conjugation/Label : | Biotin |
Molecular Mass : | 34.8 kDa |
AA Sequence : | LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | < 0.1 EU/μg by LAL |
Purity : | > 95% by SDS-PAGE |
Calculated PI : | 6.02 |
Calculated Extinction Coefficient (M-1 cm-1, at 280nm) : | 47870 |
Storage Buffer : | Sterile PBS pH7.4 (carrier and preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure. |
Concentration : | 0.5 mg/mL |
Gene Name | PSCA prostate stem cell antigen [ Homo sapiens (human) ] |
Official Symbol | PSCA |
Synonyms | PSCA; prostate stem cell antigen; PRO232; lncPSCA |
Gene ID | 8000 |
mRNA Refseq | NM_005672 |
Protein Refseq | NP_005663 |
MIM | 602470 |
UniProt ID | O43653 |
◆ Recombinant Proteins | ||
PSCA-5744H | Recombinant Human PSCA protein, hFc-tagged | +Inquiry |
PSCA-01HP | Recombinant Human PSCA Protein, C-His-tagged, PE-labeled | +Inquiry |
PSCA-151H | Recombinant Human PSCA Protein, His-tagged | +Inquiry |
PSCA-3378H | Recombinant Human PSCA protein, GST-tagged | +Inquiry |
PSCA-2002H | Recombinant Human PSCA protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSCA-2791HCL | Recombinant Human PSCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSCA Products
Required fields are marked with *
My Review for All PSCA Products
Required fields are marked with *
0
Inquiry Basket