Recombinant Human PROK1 protein

• Cat.No.: PROK1-43H
• Product Overview: Recombinant Human PROK1 protein was expressed in Escherichia coli.

Specification

• Description: The protein encoded by this gene induces proliferation, migration, and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. It has little or no effect on a variety of other endothelial and non-endothelial cell types. Its expression is restricted to the steroidogenic glands (ovary, testis, adrenal, and placenta), is induced by hypoxia, and often complementary to the expression of vascular endothelial growth factor (VEGF), suggesting that these molecules function in a coordinated manner.
• Source: E.coli
• Species: Human
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, 0.02 % Tween-20.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using bovine EJG cells is less than 2.0 μg/ml, corresponding to a specific activity of > 500 IU/mg.
• Molecular Mass: Approximately 9.7 kDa, a single non-glycosylated polypeptide chain containing 86 amino acids.
• Protein length: 86
• AA Sequence: AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
• Endotoxin: Less than 0.1 EU/µg of rHuEG-VEGF as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: PROK1
• Official Symbol: PROK1
• Synonyms: PROK1; prokineticin 1; prokineticin-1; black mamba toxin related protein; EGVEGF; mambakine; PK1; PRK1; EG-VEGF; black mamba toxin-related protein; endocrine-gland-derived vascular endothelial growth factor
• Gene ID: 84432
• mRNA Refseq: NM_032414
• Protein Refseq: NP_115790
• MIM: 606233
• UniProt ID: P58294