Recombinant Human PROK1 Protein
Cat.No. : | PROK1-230H |
Product Overview : | Recombinant Human PROK1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Endocrine gland-derived vascular endothelial growth factor (EG-VEGF) is an angiogenic growth factor that is expressed in the ovaries, testis, adrenal, and placental tissues. EG-VEGF has mitogenic, chemoattractive, and antiapoptotic functional roles. EG-VEGF signaling is mediated through binding the G protein-coupled receptors prokineticin receptor 1 (PKR1) and prokineticin receptor 2 (PKR2). Polycystic ovaries display strong EG-VEGF expression that is associated with increased angiogenesis and cyst formation, which could lead to the formation of polycystic ovary syndrome and infertility. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 9.7 kDa (86 aa) |
AA Sequence : | AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade, and avoid repeat freeze thaws. |
Gene Name | PROK1 prokineticin 1 [ Homo sapiens (human) ] |
Official Symbol | PROK1 |
Synonyms | PROK1; prokineticin 1; prokineticin-1; black mamba toxin related protein; EGVEGF; mambakine; PK1; PRK1; EG-VEGF; black mamba toxin-related protein; endocrine-gland-derived vascular endothelial growth factor; |
Gene ID | 84432 |
mRNA Refseq | NM_032414 |
Protein Refseq | NP_115790 |
MIM | 606233 |
UniProt ID | P58294 |
◆ Recombinant Proteins | ||
PROK1-4712R | Recombinant Rat PROK1 Protein | +Inquiry |
Prok1-1200M | Recombinant Mouse Prok1 Protein, His&SUMO-tagged | +Inquiry |
PROK1-3618R | Recombinant Rhesus monkey PROK1 Protein, His-tagged | +Inquiry |
PROK1-230H | Recombinant Human PROK1 Protein | +Inquiry |
PROK1-7517H | Recombinant Human PROK1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROK1-001HCL | Recombinant Human PROK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PROK1 Products
Required fields are marked with *
My Review for All PROK1 Products
Required fields are marked with *
0
Inquiry Basket