Recombinant Human PROC protein(51-190 aa), N-SUMO & C-His-tagged
Cat.No. : | PROC-2537H |
Product Overview : | Recombinant Human PROC protein(P04070)(51-190 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 51-190 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | RHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRM |
Gene Name | PROC protein C (inactivator of coagulation factors Va and VIIIa) [ Homo sapiens ] |
Official Symbol | PROC |
Synonyms | PROC; protein C (inactivator of coagulation factors Va and VIIIa); vitamin K-dependent protein C; autoprothrombin IIA; anticoagulant protein C; blood coagulation factor XIV; PC; APC; PROC1; THPH3; THPH4; |
Gene ID | 5624 |
mRNA Refseq | NM_000312 |
Protein Refseq | NP_000303 |
MIM | 612283 |
UniProt ID | P04070 |
◆ Recombinant Proteins | ||
PROC-6011C | Recombinant Chicken PROC | +Inquiry |
PROC-59H | Recombinant Human PROC, His-tagged | +Inquiry |
PROC-6007H | Recombinant Human PROC Protein (Thr19-Pro461), C-His tagged | +Inquiry |
PROC-1772H | Recombinant Human PROC Protein, His (Fc)-Avi-tagged | +Inquiry |
PROC-25H | Active Recombinant Human PROC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PROC-269B | Active Native Bovine Protein C | +Inquiry |
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
Proc-5346M | Native Mouse Protein C | +Inquiry |
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
PROC-272B | Active Native Bovine Activated Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROC-747MCL | Recombinant Mouse PROC cell lysate | +Inquiry |
PROC-852HCL | Recombinant Human PROC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PROC Products
Required fields are marked with *
My Review for All PROC Products
Required fields are marked with *
0
Inquiry Basket