Recombinant Human PROC protein(51-190 aa), N-SUMO & C-His-tagged

• Cat.No.: PROC-2537H
• Product Overview: Recombinant Human PROC protein(P04070)(51-190 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-SUMO & C-His
• Protein length: 51-190 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: RHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRM
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: PROC protein C (inactivator of coagulation factors Va and VIIIa) [ Homo sapiens ]
• Official Symbol: PROC
• Synonyms: PROC; protein C (inactivator of coagulation factors Va and VIIIa); vitamin K-dependent protein C; autoprothrombin IIA; anticoagulant protein C; blood coagulation factor XIV; PC; APC; PROC1; THPH3; THPH4
• Gene ID: 5624
• mRNA Refseq: NM_000312
• Protein Refseq: NP_000303
• MIM: 612283
• UniProt ID: P04070