Recombinant Human PRMT5 protein, His-tagged

• Cat.No.: PRMT5-7844H
• Product Overview: Recombinant Human PRMT5 protein(1-280 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-His
• Protein length: 1-280 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSY
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: PRMT5 protein arginine methyltransferase 5 [ Homo sapiens ]
• Official Symbol: PRMT5
• Synonyms: PRMT5; protein arginine methyltransferase 5; HRMT1L5, SKB1, skb1 (S. pombe) homolog , SKB1 homolog (S. pombe); protein arginine N-methyltransferase 5; SKB1Hs; SKB1 homolog; jak-binding protein 1; 72 kDa ICln-binding protein; HMT1 hnRNP methyltransferase-like 5; shk1 kinase-binding protein 1 homolog; histone-arginine N-methyltransferase PRMT5; JBP1; SKB1; IBP72; HRMT1L5
• Gene ID: 10419
• mRNA Refseq: NM_001039619
• Protein Refseq: NP_001034708
• MIM: 604045
• UniProt ID: O14744