Recombinant Human PRMT5 protein, GST-tagged

• Cat.No.: PRMT5-301624H
• Product Overview: Recombinant Human PRMT5 (283-637 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Tyr283-Leu637
• AA Sequence: YLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: PRMT5 protein arginine methyltransferase 5 [ Homo sapiens ]
• Official Symbol: PRMT5
• Synonyms: PRMT5; protein arginine methyltransferase 5; HRMT1L5, SKB1, skb1 (S. pombe) homolog , SKB1 homolog (S. pombe); protein arginine N-methyltransferase 5; SKB1Hs; SKB1 homolog; jak-binding protein 1; 72 kDa ICln-binding protein; HMT1 hnRNP methyltransferase-like 5; shk1 kinase-binding protein 1 homolog; histone-arginine N-methyltransferase PRMT5; JBP1; SKB1; IBP72; HRMT1L5
• Gene ID: 10419
• mRNA Refseq: NM_001039619
• Protein Refseq: NP_001034708
• MIM: 604045
• UniProt ID: O14744