Recombinant Full Length Human PRMT5 Protein, C-Flag-tagged
Cat.No. : | PRMT5-688HFL |
Product Overview : | Recombinant Full Length Human PRMT5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an enzyme that belongs to the methyltransferase family. The encoded protein catalyzes the transfer of methyl groups to the amino acid arginine, in target proteins that include histones, transcriptional elongation factors and the tumor suppressor p53. This gene plays a role in several cellular processes, including transcriptional regulation, and the assembly of small nuclear ribonucleoproteins. A pseudogene of this gene has been defined on chromosome 4. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 72.5 kDa |
AA Sequence : | MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSD LLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTN HIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGA DLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSY LQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVP EEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREK DRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLY QDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTG RSYTIGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Stem cell - Pluripotency |
Full Length : | Full L. |
Gene Name | PRMT5 protein arginine methyltransferase 5 [ Homo sapiens (human) ] |
Official Symbol | PRMT5 |
Synonyms | HSL7; JBP1; SKB1; IBP72; SKB1Hs; HRMT1L5 |
Gene ID | 10419 |
mRNA Refseq | NM_006109.5 |
Protein Refseq | NP_006100.2 |
MIM | 604045 |
UniProt ID | O14744 |
◆ Recombinant Proteins | ||
PRMT5&MEP50-315H | Recombinant Human PRMT5&MEP50 protein, Flag/His-tagged | +Inquiry |
PRMT5-7844H | Recombinant Human PRMT5 protein, His-tagged | +Inquiry |
PRMT5-688HFL | Recombinant Full Length Human PRMT5 Protein, C-Flag-tagged | +Inquiry |
PRMT5-1771H | Recombinant Human PRMT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRMT5-3632H | Recombinant Human PRMT5 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRMT5-2577HCL | Recombinant Human PRMT5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRMT5 Products
Required fields are marked with *
My Review for All PRMT5 Products
Required fields are marked with *
0
Inquiry Basket