Recombinant Human PRMT3 protein, T7/His-tagged
Cat.No. : | PRMT3-119H |
Product Overview : | Recombinant human PRMT3 cDNA (465aa, derived from BC001878, isoform 1) fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 465 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQG^GEFCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQ QTPCLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYL KPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMH TDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSM FAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLY AKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKH IDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAG EALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human PRMT3 functional regulations using protein mediated intracellular dilivery study.2. May be used for specific substrate protein for kinase and ubiquitin related enzyme functional screening assays.3. May be used as antigen for specific antibody production. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | PRMT3 protein arginine methyltransferase 3 [ Homo sapiens ] |
Official Symbol | PRMT3 |
Synonyms | PRMT3; protein arginine methyltransferase 3; HMT1 hnRNP methyltransferase like 3 (S. cerevisiae) , HRMT1L3 |
Gene ID | 10196 |
mRNA Refseq | NM_001145166 |
Protein Refseq | NP_001138638 |
MIM | 603190 |
UniProt ID | O60678 |
Chromosome Location | 11p15.1 |
Function | metal ion binding; protein-arginine N-methyltransferase activity; protein-arginine omega-N asymmetric methyltransferase activity; transferase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
PRMT3-5042H | Recombinant Human PRMT3 Protein, GST-tagged | +Inquiry |
PRMT3-1617H | Recombinant Human Protein Arginine Methyltransferase 3, GST-tagged | +Inquiry |
PRMT3-5200H | Recombinant Human PRMT3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRMT3-097H | Recombinant Human PRMT3 Protein, GST-tagged | +Inquiry |
PRMT3-3003H | Recombinant Human PRMT3 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRMT3 Products
Required fields are marked with *
My Review for All PRMT3 Products
Required fields are marked with *
0
Inquiry Basket