Recombinant Human PRMT3 Protein, GST-tagged

• Cat.No.: PRMT3-5042H
• Product Overview: Human HRMT1L3 partial ORF ( NP_005779, 41 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Type I protein arginine N-methyltransferases (PRMTs), such as PRMT3, catalyze the formation of asymmetric N(G),N(G)-dimethylarginine (ADMA) residues in proteins (Tang et al., 1998 [PubMed 9642256]).[supplied by OMIM
• Molecular Mass: 36.63 kDa
• AA Sequence: LPHGKQQTPCLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PRMT3 protein arginine methyltransferase 3 [ Homo sapiens ]
• Official Symbol: PRMT3
• Synonyms: PRMT3; protein arginine methyltransferase 3; HMT1 hnRNP methyltransferase like 3 (S. cerevisiae) , HRMT1L3; protein arginine N-methyltransferase 3; HMT1 hnRNP methyltransferase-like 3; heterogeneous nuclear ribonucleoprotein methyltransferase-like 3; heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3; HRMT1L3
• Gene ID: 10196
• mRNA Refseq: NM_001145166
• Protein Refseq: NP_001138638
• MIM: 603190
• UniProt ID: O60678