Recombinant Human PRDX6, His-tagged

• Cat.No.: PRDX6-27600TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-224 of Human Peroxiredoxin 6 with an N terminal His tag; Predicted MWt 26 kDa.

Specification

• Description: The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 105 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Store at 4°C. Upon reconstitution store at -80oC.
• Sequences of amino acids: MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHP RDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVED HLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGM LDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTG RNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIP EEEAKKLFPKGVFTKELPSGKKYLRYTPQP
• Sequence Similarities: Belongs to the ahpC/TSA family. Rehydrin subfamily.Contains 1 thioredoxin domain.
• Protein length: 1-224 a.a.
• Full Length: Full L.

Gene Information

• Gene Name: PRDX6 peroxiredoxin 6 [ Homo sapiens ]
• Official Symbol: PRDX6
• Synonyms: PRDX6; peroxiredoxin 6; peroxiredoxin-6; 1 Cys; aiPLA2; AOP2; KIAA0106; MGC46173; NSGPx; p29; PRX
• Gene ID: 9588
• mRNA Refseq: NM_004905
• Protein Refseq: NP_004896
• MIM: 602316
• Uniprot ID: P30041
• Chromosome Location: 1q24.1
• Pathway: Metabolic pathways, organism-specific biosystem; Phenylalanine metabolism, organism-specific biosystem; Phenylalanine metabolism, conserved biosystem
• Function: antioxidant activity; glutathione peroxidase activity; hydrolase activity; oxidoreductase activity; peroxiredoxin activity