Recombinant Human PRDX6, His-tagged
Cat.No. : | PRDX6-27600TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-224 of Human Peroxiredoxin 6 with an N terminal His tag; Predicted MWt 26 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-224 a.a. |
Description : | The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 105 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHP RDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVED HLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGM LDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTG RNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIP EEEAKKLFPKGVFTKELPSGKKYLRYTPQP |
Sequence Similarities : | Belongs to the ahpC/TSA family. Rehydrin subfamily.Contains 1 thioredoxin domain. |
Full Length : | Full L. |
Gene Name | PRDX6 peroxiredoxin 6 [ Homo sapiens ] |
Official Symbol | PRDX6 |
Synonyms | PRDX6; peroxiredoxin 6; peroxiredoxin-6; 1 Cys; aiPLA2; AOP2; KIAA0106; MGC46173; NSGPx; p29; PRX; |
Gene ID | 9588 |
mRNA Refseq | NM_004905 |
Protein Refseq | NP_004896 |
MIM | 602316 |
Uniprot ID | P30041 |
Chromosome Location | 1q24.1 |
Pathway | Metabolic pathways, organism-specific biosystem; Phenylalanine metabolism, organism-specific biosystem; Phenylalanine metabolism, conserved biosystem; |
Function | antioxidant activity; glutathione peroxidase activity; hydrolase activity; oxidoreductase activity; peroxiredoxin activity; |
◆ Recombinant Proteins | ||
PRDX6-13327M | Recombinant Mouse PRDX6 Protein | +Inquiry |
PRDX6-6622H | Recombinant Human PRDX6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Prdx6-612M | Recombinant Mouse Prdx6 Protein, MYC/DDK-tagged | +Inquiry |
PRDX6-4662R | Recombinant Rat PRDX6 Protein | +Inquiry |
PRDX6-647HFL | Recombinant Full Length Human PRDX6 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDX6-2877HCL | Recombinant Human PRDX6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRDX6 Products
Required fields are marked with *
My Review for All PRDX6 Products
Required fields are marked with *
0
Inquiry Basket