Recombinant Full Length Human PRDX6 Protein, C-Flag-tagged

• Cat.No.: PRDX6-647HFL
• Product Overview: Recombinant Full Length Human PRDX6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 24.9 kDa
• AA Sequence: MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIA LSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPD KKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKE
  LPSGKKYLRYTPQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Methane metabolism, Phenylalanine metabolism
• Full Length: Full L.

Gene Information

• Gene Name: PRDX6 peroxiredoxin 6 [ Homo sapiens (human) ]
• Official Symbol: PRDX6
• Synonyms: PRX; p29; AOP2; 1-Cys; NSGPx; aiPLA2; LPCAT-5; HEL-S-128m
• Gene ID: 9588
• mRNA Refseq: NM_004905.3
• Protein Refseq: NP_004896.1
• MIM: 602316
• UniProt ID: P30041