Recombinant Human PRDM2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PRDM2-5535H
• Product Overview: PRDM2 MS Standard C13 and N15-labeled recombinant protein (NP_001129082) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This tumor suppressor gene is a member of a nuclear histone/protein methyltransferase superfamily. It encodes a zinc finger protein that can bind to retinoblastoma protein, estrogen receptor, and the TPA-responsive element (MTE) of the heme-oxygenase-1 gene. Although the functions of this protein have not been fully characterized, it may (1) play a role in transcriptional regulation during neuronal differentiation and pathogenesis of retinoblastoma, (2) act as a transcriptional activator of the heme-oxygenase-1 gene, and (3) be a specific effector of estrogen action. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 25.3 kDa
• AA Sequence: MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKATASAWRPDALHQRPRTSPGSIGRSKLQLQPSSRDHSSKSRHSGCSLTAPEVTWNQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PRDM2 PR/SET domain 2 [ Homo sapiens (human) ]
• Official Symbol: PRDM2
• Synonyms: PRDM2; PR domain containing 2, with ZNF domain; PR domain zinc finger protein 2; GATA 3 binding protein G3B; HUMHOXY1; KMT8; MTB ZF; MTE binding protein; retinoblastoma protein binding zinc finger protein; retinoblastoma protein interacting zinc finger protein; RIZ; RIZ1; RIZ2; zinc finger DNA binding protein; MTE-binding protein; zinc finger protein RIZ; GATA-3 binding protein G3B; GATA-3-binding protein G3B; lysine N-methyltransferase 8; PR domain-containing protein 2; zinc-finger DNA-binding protein; retinoblastoma protein-binding zinc finger protein; retinoblastoma protein-interacting zinc finger protein; MTB-ZF
• Gene ID: 7799
• mRNA Refseq: NM_001135610
• Protein Refseq: NP_001129082
• MIM: 601196
• UniProt ID: Q13029