Recombinant Human PRDM16 protein, GST-tagged

Cat.No. : PRDM16-301430H
Product Overview : Recombinant Human PRDM16 (1080-1230 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ile1080-Lys1230
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : IANSEMNQASTRTEKRADMQIVDGSAQCPGLASEKQEDVEEEDDDDLEEDDEDSLAGKSQDDTVSPAPEPQAAYEDEEDEEPAASLAVGFDHTRRCAEDHEGGLLALEPMPTFGKGLDLRRAAEEAFEVKDVLNSTLDSEALKHTLCRQAK
Gene Name PRDM16 PR domain containing 16 [ Homo sapiens ]
Official Symbol PRDM16
Synonyms PRDM16; PR domain containing 16; PR domain zinc finger protein 16; KIAA1675; MDS1/EVI1 like; MEL1; MGC166915; PFM13; transcription factor MEL1; MDS1/EVI1-like gene 1;
Gene ID 63976
mRNA Refseq NM_022114
Protein Refseq NP_071397
MIM 605557
UniProt ID Q9HAZ2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PRDM16 Products

Required fields are marked with *

My Review for All PRDM16 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon