Species :	Human
Source :	E.coli
Tag :	GST
ProteinLength :	Ile1080-Lys1230
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence :	IANSEMNQASTRTEKRADMQIVDGSAQCPGLASEKQEDVEEEDDDDLEEDDEDSLAGKSQDDTVSPAPEPQAAYEDEEDEEPAASLAVGFDHTRRCAEDHEGGLLALEPMPTFGKGLDLRRAAEEAFEVKDVLNSTLDSEALKHTLCRQAK

Gene Name	PRDM16 PR domain containing 16 [ Homo sapiens ]
Official Symbol	PRDM16
Synonyms	PRDM16; PR domain containing 16; PR domain zinc finger protein 16; KIAA1675; MDS1/EVI1 like; MEL1; MGC166915; PFM13; transcription factor MEL1; MDS1/EVI1-like gene 1;
Gene ID	63976
mRNA Refseq	NM_022114
Protein Refseq	NP_071397
MIM	605557
UniProt ID	Q9HAZ2

◆ Recombinant Proteins
BTLA-1525R	Recombinant Rhesus Monkey BTLA Protein, hIgG1-tagged	+Inquiry
MPXV-0804	Recombinant Monkeypox Virus Protein, MPXVgp182	+Inquiry
RFL688TF	Recombinant Full Length Tamias Rufus Cytochrome C Oxidase Subunit 2(Mt-Co2) Protein, His-Tagged	+Inquiry
Ctla4-41M	Recombinant Mouse Ctla4 Protein, hIgG-His-tagged	+Inquiry
METTL11A-2737R	Recombinant Rhesus monkey METTL11A Protein, His-tagged	+Inquiry
See All BTLA Recombinant Proteins

◆ Native Proteins
Collagen-121B	Native Bovine Type II Collagen, FITC-tagged	+Inquiry
ALB-38R	Native Rhesus monkey Albumin (ALB) Protein	+Inquiry
Lectin-1794A	Active Native Artocarpus integrifolia Jacalin Protein, Fluorescein labeled	+Inquiry
HB-41D	Native Dog Hemoglobin (HB) Protein	+Inquiry
TNC-08H	Native Human TNC Protein	+Inquiry
See All Collagen Native Proteins

◆ Cell & Tissue Lysates
UAP1-607HCL	Recombinant Human UAP1 293 Cell Lysate	+Inquiry
COL9A3-7374HCL	Recombinant Human COL9A3 293 Cell Lysate	+Inquiry
GRWD1-5729HCL	Recombinant Human GRWD1 293 Cell Lysate	+Inquiry
RAB33A-2606HCL	Recombinant Human RAB33A 293 Cell Lysate	+Inquiry
LYAR-1040HCL	Recombinant Human LYAR cell lysate	+Inquiry
See All UAP1 Cell & Tissue Lysates