Recombinant Human PRDM16, His-tagged

• Cat.No.: PRDM16-31106TH
• Product Overview: Recombinant fragment, corresponding to amino acids 984-1275 of Human PRDM16 with N terminal His tag; 292 amino acids, 39kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 984-1275 a.a.
• Description: The reciprocal translocation t(1;3)(p36;q21) occurs in a subset of myelodysplastic syndrome (MDS) and acute myeloid leukemia (AML). This gene is located near the 1p36.3 breakpoint and has been shown to be specifically expressed in the t(1:3)(p36,q21)-positive MDS/AML. The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal PR domain. The translocation results in the overexpression of a truncated version of this protein that lacks the PR domain, which may play an important role in the pathogenesis of MDS and AML. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
• Conjugation: HIS
• Tissue specificity: Expressed in uterus and kidney.
• Form: Lyophilised:Reconstitute with 108 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLD RHLKKHEHENAPVSQHPGVLTNHLGTSASSPTSESDNH ALLDEKEDSYFSEIRNFIANSEMNQASTRTEKRADMQIVDGSAQCPGLASEKQEDVEEEDDDDLEEDDEDSLAGKSQD DTVSPAPEPQAAYEDEEDEEPAASLAVGFDHTRRCAED HEGGLLALEPMPTFGKGLDLRRAAEEAFEVKDVLNSTLDS EALKHTLCRQAKNQAYAMMLSLSEDTPLHTPSQGSLDA WLKVTGATSESGAFHPINHL
• Sequence Similarities: Contains 10 C2H2-type zinc fingers.Contains 1 SET domain.

Gene Information

• Gene Name: PRDM16 PR domain containing 16 [ Homo sapiens ]
• Official Symbol: PRDM16
• Synonyms: PRDM16; PR domain containing 16; PR domain zinc finger protein 16; KIAA1675; MDS1/EVI1 like; MEL1; MGC166915; PFM13; transcription factor MEL1
• Gene ID: 63976
• mRNA Refseq: NM_199454
• Protein Refseq: NP_955533
• MIM: 605557
• Uniprot ID: Q9HAZ2
• Chromosome Location: 1p36.23-p33
• Function: SMAD binding; metal ion binding; protein binding; sequence-specific DNA binding; transcription coactivator activity