Recombinant Human PRAG1 Protein, GST-tagged

• Cat.No.: PRAG1-4027H
• Product Overview: Human DKFZp761P0423 partial ORF ( XP_291277, 2 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an enzyme that belongs to the tyrosine protein kinase family. A similar protein in rat binds to Rho family GTPase 2 (Rnd2) and regulates neurite outgrowth via activation of Ras homolog gene family, member A (RhoA). [provided by RefSeq, Mar 2014]
• Molecular Mass: 36.74 kDa
• AA Sequence: HQTLCLNPESLKMSACSDFVEHIWKPGSCKNCFCLRSDHQLVAGPPQPRAGSLPPPPRLPPRPENCRLEDEGVNSSPYSKPTIAVKPTMMSSEASDVWTE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PRAG1 PEAK1 related, kinase-activating pseudokinase 1 [ Homo sapiens (human) ]
• Official Symbol: PRAG1
• Synonyms: PRAG1; PEAK1 related, kinase-activating pseudokinase 1; PEAK1 Related Kinase Activating Pseudokinase 1; Sugen Kinase 223; Pragmin, RND2 Effector Protein; SGK223; Tyrosine-Protein Kinase SgK223; Homolog Of Rat Pragma Of Rnd2; EC 2.7.10.2; PRAGMIN; PEAK2; NACK; tyrosine-protein kinase PRAG1; tyrosine-protein kinase SgK223; PEAK family member 2; Pragmin, RND2 effector protein; homolog of rat pragma of Rnd2; sugen kinase 223
• Gene ID: 157285
• mRNA Refseq: NM_001080826
• Protein Refseq: NP_001074295
• MIM: 617344
• UniProt ID: Q86YV5