Recombinant Human PRAG1 Protein, GST-tagged
Cat.No. : | PRAG1-4027H |
Product Overview : | Human DKFZp761P0423 partial ORF ( XP_291277, 2 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an enzyme that belongs to the tyrosine protein kinase family. A similar protein in rat binds to Rho family GTPase 2 (Rnd2) and regulates neurite outgrowth via activation of Ras homolog gene family, member A (RhoA). [provided by RefSeq, Mar 2014] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | HQTLCLNPESLKMSACSDFVEHIWKPGSCKNCFCLRSDHQLVAGPPQPRAGSLPPPPRLPPRPENCRLEDEGVNSSPYSKPTIAVKPTMMSSEASDVWTE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PRAG1 PEAK1 related, kinase-activating pseudokinase 1 [ Homo sapiens (human) ] |
Official Symbol | PRAG1 |
Synonyms | PRAG1; PEAK1 related, kinase-activating pseudokinase 1; PEAK1 Related Kinase Activating Pseudokinase 1; Sugen Kinase 223; Pragmin, RND2 Effector Protein; SGK223; Tyrosine-Protein Kinase SgK223; Homolog Of Rat Pragma Of Rnd2; EC 2.7.10.2; PRAGMIN; PEAK2; NACK; tyrosine-protein kinase PRAG1; tyrosine-protein kinase SgK223; PEAK family member 2; Pragmin, RND2 effector protein; homolog of rat pragma of Rnd2; sugen kinase 223 |
Gene ID | 157285 |
mRNA Refseq | NM_001080826 |
Protein Refseq | NP_001074295 |
MIM | 617344 |
UniProt ID | Q86YV5 |
◆ Recombinant Proteins | ||
PRAG1-4027H | Recombinant Human PRAG1 Protein, GST-tagged | +Inquiry |
PRAG1-1026HFL | Recombinant Full Length Human PRAG1 Protein, C-Flag-tagged | +Inquiry |
PRAG1-1753H | Recombinant Human PRAG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Prag1-5094M | Recombinant Mouse Prag1 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRAG1 Products
Required fields are marked with *
My Review for All PRAG1 Products
Required fields are marked with *
0
Inquiry Basket