Recombinant Human PRAG1 Protein, GST-tagged

Cat.No. : PRAG1-4027H
Product Overview : Human DKFZp761P0423 partial ORF ( XP_291277, 2 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an enzyme that belongs to the tyrosine protein kinase family. A similar protein in rat binds to Rho family GTPase 2 (Rnd2) and regulates neurite outgrowth via activation of Ras homolog gene family, member A (RhoA). [provided by RefSeq, Mar 2014]
Molecular Mass : 36.74 kDa
AA Sequence : HQTLCLNPESLKMSACSDFVEHIWKPGSCKNCFCLRSDHQLVAGPPQPRAGSLPPPPRLPPRPENCRLEDEGVNSSPYSKPTIAVKPTMMSSEASDVWTE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PRAG1 PEAK1 related, kinase-activating pseudokinase 1 [ Homo sapiens (human) ]
Official Symbol PRAG1
Synonyms PRAG1; PEAK1 related, kinase-activating pseudokinase 1; PEAK1 Related Kinase Activating Pseudokinase 1; Sugen Kinase 223; Pragmin, RND2 Effector Protein; SGK223; Tyrosine-Protein Kinase SgK223; Homolog Of Rat Pragma Of Rnd2; EC 2.7.10.2; PRAGMIN; PEAK2; NACK; tyrosine-protein kinase PRAG1; tyrosine-protein kinase SgK223; PEAK family member 2; Pragmin, RND2 effector protein; homolog of rat pragma of Rnd2; sugen kinase 223
Gene ID 157285
mRNA Refseq NM_001080826
Protein Refseq NP_001074295
MIM 617344
UniProt ID Q86YV5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PRAG1 Products

Required fields are marked with *

My Review for All PRAG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon