| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-278 a.a. |
| Description : |
The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a beta isoform of the regulatory subunit B55 subfamily. Defects in this gene cause autosomal dominant spinocerebellar ataxia 12 (SCA12), a disease caused by degeneration of the cerebellum, sometimes involving the brainstem and spinal cord, and in resulting in poor coordination of speech and body movements. Multiple alternatively spliced variants, which encode different isoforms, have been identified for this gene. The 5 UTR of some of these variants includes a CAG trinucleotide repeat sequence (7-28 copies) that can be expanded to 66-78 copies in cases of SCA12. |
| Conjugation : |
HIS |
| Form : |
Lyophilised:Reconstitute with 71 μl aqua dest. |
| Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLA TGDKGGRVVIFQREQESKNQVHRRGEYNVYSTFQSHEP EFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVK LWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLR PMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDL RINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHP HHCNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPED PSNRSFFS |