Recombinant Human PPP2CB Protein (1-309 aa), GST-tagged
Cat.No. : | PPP2CB-1178H |
Product Overview : | Recombinant Human PPP2CB Protein (1-309 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-309 aa |
Description : | PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 62.6 kDa |
AA Sequence : | MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | PPP2CB protein phosphatase 2, catalytic subunit, beta isozyme [ Homo sapiens ] |
Official Symbol | PPP2CB |
Synonyms | PPP2CB; PP2Abeta; beta isoform; PP2A-beta; PP2CB; |
Gene ID | 5516 |
mRNA Refseq | NM_001009552 |
Protein Refseq | NP_001009552 |
MIM | 176916 |
UniProt ID | P62714 |
◆ Recombinant Proteins | ||
PPP2CB-6681C | Recombinant Chicken PPP2CB | +Inquiry |
PPP2CB-1178H | Recombinant Human PPP2CB Protein (1-309 aa), GST-tagged | +Inquiry |
PPP2CB-7030M | Recombinant Mouse PPP2CB Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2CB-650H | Recombinant Human PPP2CB Protein, His-tagged | +Inquiry |
PPP2CB-4632R | Recombinant Rat PPP2CB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2CB-2927HCL | Recombinant Human PPP2CB 293 Cell Lysate | +Inquiry |
PPP2CB-2928HCL | Recombinant Human PPP2CB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP2CB Products
Required fields are marked with *
My Review for All PPP2CB Products
Required fields are marked with *
0
Inquiry Basket