Recombinant Human PPP1R3A

• Cat.No.: PPP1R3A-31051TH
• Product Overview: Recombinant fragment of Human PPP1R3A with an N terminal proprietary tag; Predicted MWt 36.52 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: The glycogen-associated form of protein phosphatase-1 (PP1) derived from skeletal muscle is a heterodimer composed of a 37-kD catalytic subunit and a 124-kD targeting and regulatory subunit. This gene encodes the regulatory subunit which binds to muscle glycogen with high affinity, thereby enhancing dephosphorylation of glycogen-bound substrates for PP1 such as glycogen synthase and glycogen phosphorylase kinase.
• Molecular Weight: 36.520kDa inclusive of tags
• Tissue specificity: Skeletal muscle and heart.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSEDIYLDTPSSGTRRVSFADSFGFNLVSVKEFDCWELPSASTTFDLGTDIFHT
• Sequence Similarities: Contains 1 CBM21 (carbohydrate binding type-21) domain.

Gene Information

• Gene Name: PPP1R3A protein phosphatase 1, regulatory subunit 3A [ Homo sapiens ]
• Official Symbol: PPP1R3A
• Synonyms: PPP1R3A; protein phosphatase 1, regulatory subunit 3A; PPP1R3, protein phosphatase 1, regulatory (inhibitor) subunit 3A , protein phosphatase 1, regulatory (inhibitor) subunit 3A (glycogen and sarcoplasmic reticulum binding subunit, skeletal muscle); pr
• Gene ID: 5506
• mRNA Refseq: NM_002711
• Protein Refseq: NP_002702
• MIM: 600917
• Uniprot ID: Q16821
• Chromosome Location: 7q31.1
• Pathway: Insulin Signaling, organism-specific biosystem; Insulin signaling pathway, organism-specific biosystem; Insulin signaling pathway, conserved biosystem; Insulin-mediated glucose transport, organism-specific biosystem