Recombinant Human PPP1R35 Protein, GST-tagged

• Cat.No.: PPP1R35-5240H
• Product Overview: Human C7orf47 full-length ORF ( NP_659467.1, 1 a.a. - 253 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: PPP1R35 (Protein Phosphatase 1 Regulatory Subunit 35) is a Protein Coding gene. GO annotations related to this gene include phosphatase binding and protein phosphatase inhibitor activity.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 54.4 kDa
• AA Sequence: MMMGCGESELKSADGEEAAAVPGPPPEPQVPQLRAPVPEPGLDLSLSPRPDSPQPRHGSPGRRKGRAERRGAARQRRQVRFRLTPPSPVRSEPQPAVPQELEMPVLKSSLALGLELRAAAGSHFDAAKAVEEQLRKSFQIRCGLEESVSEGLNVPRSKRLFRDLVSLQVPEEQVLNAALREKLALLPPQARAPHPKEPPGPGPDMTILCDPETLFYESPHLTLDGLPPLRLQLRPRPSEDTFLMHRTLRRWEA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PPP1R35 protein phosphatase 1 regulatory subunit 35 [ Homo sapiens (human) ]
• Official Symbol: PPP1R35
• Synonyms: C7orf47; PPP1R35; protein phosphatase 1 regulatory subunit 35; protein phosphatase 1 regulatory subunit 35; UPF0683 protein C7orf47
• Gene ID: 221908
• mRNA Refseq: NM_001346938
• Protein Refseq: NP_001333867
• UniProt ID: Q8TAP8