Recombinant Full Length Human PPP1R35 Protein, GST-tagged
Cat.No. : | PPP1R35-3900HF |
Product Overview : | Human C7orf47 full-length ORF ( NP_659467.1, 1 a.a. - 253 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 253 amino acids |
Description : | PPP1R35 (Protein Phosphatase 1 Regulatory Subunit 35) is a Protein Coding gene. GO annotations related to this gene include phosphatase binding and protein phosphatase inhibitor activity. |
Molecular Mass : | 54.4 kDa |
AA Sequence : | MMMGCGESELKSADGEEAAAVPGPPPEPQVPQLRAPVPEPGLDLSLSPRPDSPQPRHGSPGRRKGRAERRGAARQRRQVRFRLTPPSPVRSEPQPAVPQELEMPVLKSSLALGLELRAAAGSHFDAAKAVEEQLRKSFQIRCGLEESVSEGLNVPRSKRLFRDLVSLQVPEEQVLNAALREKLALLPPQARAPHPKEPPGPGPDMTILCDPETLFYESPHLTLDGLPPLRLQLRPRPSEDTFLMHRTLRRWEA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PPP1R35 protein phosphatase 1 regulatory subunit 35 [ Homo sapiens (human) ] |
Official Symbol | PPP1R35 |
Synonyms | C7orf47; PPP1R35; protein phosphatase 1 regulatory subunit 35; protein phosphatase 1 regulatory subunit 35; UPF0683 protein C7orf47 |
Gene ID | 221908 |
mRNA Refseq | NM_001346938 |
Protein Refseq | NP_001333867 |
MIM | 618937 |
UniProt ID | Q8TAP8 |
◆ Recombinant Proteins | ||
PPP1R35-3900HF | Recombinant Full Length Human PPP1R35 Protein, GST-tagged | +Inquiry |
PPP1R35-13235M | Recombinant Mouse PPP1R35 Protein | +Inquiry |
PPP1R35-4358Z | Recombinant Zebrafish PPP1R35 | +Inquiry |
PPP1R35-5240H | Recombinant Human PPP1R35 Protein, GST-tagged | +Inquiry |
PPP1R35-7020M | Recombinant Mouse PPP1R35 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP1R35 Products
Required fields are marked with *
My Review for All PPP1R35 Products
Required fields are marked with *
0
Inquiry Basket