Recombinant Human PPP1R27 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PPP1R27-3235H
• Product Overview: DYSFIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001007534) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Inhibits phosphatase activity of protein phosphatase 1 (PP1) complexes.
• Molecular Mass: 17.4 kDa
• AA Sequence: MPSRTARYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDEAGWTPLHIACSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PPP1R27 protein phosphatase 1 regulatory subunit 27 [ Homo sapiens (human) ]
• Official Symbol: PPP1R27
• Synonyms: protein phosphatase 1, regulatory subunit 27; 16813; Ensembl:ENSG00000182676; MGC138299; protein phosphatase 1 regulatory subunit 27;toonin;dysferlin interacting protein 1;dysferlin-interacting protein 1 (toonin); DYSFIP1
• Gene ID: 116729
• mRNA Refseq: NM_001007533
• Protein Refseq: NP_001007534
• UniProt ID: Q86WC6