Recombinant Human PPP1R27 Protein, GST-tagged

• Cat.No.: PPP1R27-2995H
• Product Overview: Human DYSFIP1 full-length ORF ( NP_001007534.1, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: PPP1R27 (Protein Phosphatase 1 Regulatory Subunit 27) is a Protein Coding gene. GO annotations related to this gene include phosphatase binding and protein phosphatase inhibitor activity. An important paralog of this gene is NRARP.
• Molecular Mass: 43.8 kDa
• AA Sequence: MPSRTARYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDEAGWTPLHIACSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PPP1R27 protein phosphatase 1 regulatory subunit 27 [ Homo sapiens (human) ]
• Official Symbol: PPP1R27
• Synonyms: PPP1R27; protein phosphatase 1 regulatory subunit 27; Protein Phosphatase 1 Regulatory Subunit 27; Dysferlin-Interacting Protein 1 (Toonin); Dysferlin Interacting Protein 1; DYSFIP1; Toonin; Protein Phosphatase 1, Regulatory Subunit 27; Dysferlin Interacting Protein 1 (Toonin); Dysferlin-Interacting Protein 1; protein phosphatase 1 regulatory subunit 27; dysferlin interacting protein 1; dysferlin-interacting protein 1 (toonin); toonin
• Gene ID: 116729
• mRNA Refseq: NM_001007533
• Protein Refseq: NP_001007534
• UniProt ID: Q86WC6