Recombinant Human PPP1R1B

• Cat.No.: PPP1R1B-26806TH
• Product Overview: Recombinant full length Human DARPP32 with proprietary tag; Predicted MWt 43.89 including tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 168 amino acids
• Description: This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 43.890kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
• Sequence Similarities: Belongs to the protein phosphatase inhibitor 1 family.

Gene Information

• Gene Name: PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B [ Homo sapiens ]
• Official Symbol: PPP1R1B
• Synonyms: PPP1R1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B; protein phosphatase 1 regulatory subunit 1B; DARPP 32; dopamine and cAMP regulated phosphoprotein; FLJ20940
• Gene ID: 84152
• mRNA Refseq: NM_001242464
• Protein Refseq: NP_001229393
• MIM: 604399
• Uniprot ID: Q9UD71
• Chromosome Location: 17
• Pathway: DARPP-32 events, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; Nicotine Activity on Dopaminergic Neurons, organism-specific biosystem; Opioid Signalling, organism-specific biosystem
• Function: cAMP-dependent protein kinase inhibitor activity; protein kinase inhibitor activity; protein phosphatase inhibitor activity; protein phosphatase type 1 regulator activity; receptor binding