Recombinant Human PPP1R1B
| Cat.No. : | PPP1R1B-26806TH |
| Product Overview : | Recombinant full length Human DARPP32 with proprietary tag; Predicted MWt 43.89 including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Protein length : | 168 amino acids |
| Molecular Weight : | 43.890kDa inclusive of tags |
| Source : | Wheat germ |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT |
| Sequence Similarities : | Belongs to the protein phosphatase inhibitor 1 family. |
| Tag : | Non |
| Gene Name | PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B [ Homo sapiens ] |
| Official Symbol | PPP1R1B |
| Synonyms | PPP1R1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B; protein phosphatase 1 regulatory subunit 1B; DARPP 32; dopamine and cAMP regulated phosphoprotein; FLJ20940; |
| Gene ID | 84152 |
| mRNA Refseq | NM_001242464 |
| Protein Refseq | NP_001229393 |
| MIM | 604399 |
| Uniprot ID | Q9UD71 |
| Chromosome Location | 17 |
| Pathway | DARPP-32 events, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; Nicotine Activity on Dopaminergic Neurons, organism-specific biosystem; Opioid Signalling, organism-specific biosystem; |
| Function | cAMP-dependent protein kinase inhibitor activity; protein kinase inhibitor activity; protein phosphatase inhibitor activity; protein phosphatase type 1 regulator activity; receptor binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP1R1B Products
Required fields are marked with *
My Review for All PPP1R1B Products
Required fields are marked with *
0
Inquiry Basket
