Recombinant Full Length Human PPP1R1B Protein

Cat.No. : PPP1R1B-390HF
Product Overview : Recombinant full length Human DARPP32 with proprietary tag; Predicted MWt 43.89 including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 43.890kDa inclusive of tags
Protein length : 168 amino acids
AA Sequence : MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B [ Homo sapiens ]
Official Symbol PPP1R1B
Synonyms PPP1R1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B; protein phosphatase 1 regulatory subunit 1B; DARPP 32; dopamine and cAMP regulated phosphoprotein; FLJ20940
Gene ID 84152
mRNA Refseq NM_001242464
Protein Refseq NP_001229393
MIM 604399
UniProt ID Q9UD71

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPP1R1B Products

Required fields are marked with *

My Review for All PPP1R1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon