Recombinant Full Length Human PPP1R1B Protein
Cat.No. : | PPP1R1B-390HF |
Product Overview : | Recombinant full length Human DARPP32 with proprietary tag; Predicted MWt 43.89 including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 168 amino acids |
Description : | This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 43.890kDa inclusive of tags |
AA Sequence : | MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B [ Homo sapiens ] |
Official Symbol | PPP1R1B |
Synonyms | PPP1R1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B; protein phosphatase 1 regulatory subunit 1B; DARPP 32; dopamine and cAMP regulated phosphoprotein; FLJ20940 |
Gene ID | 84152 |
mRNA Refseq | NM_001242464 |
Protein Refseq | NP_001229393 |
MIM | 604399 |
UniProt ID | Q9UD71 |
◆ Recombinant Proteins | ||
PPP1R1B-6844H | Recombinant Human PPP1R1B protein, His-tagged | +Inquiry |
PPP1R1B-2118H | Recombinant Human PPP1R1B Protein (1-168 aa), GST-tagged | +Inquiry |
PPP1R1B-2617H | Recombinant Human PPP1R1B Protein, His-tagged | +Inquiry |
Ppp1r1b-2634R | Recombinant Rat Ppp1r1b, Phosphorylated | +Inquiry |
PPP1R1B-5421H | Recombinant Human PPP1R1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R1B-2940HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry |
PPP1R1B-2939HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP1R1B Products
Required fields are marked with *
My Review for All PPP1R1B Products
Required fields are marked with *
0
Inquiry Basket