Recombinant Human PPP1CC Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PPP1CC-3004H
• Product Overview: PPP1CC MS Standard C13 and N15-labeled recombinant protein (NP_002701) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 37 kDa
• AA Sequence: MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PPP1CC protein phosphatase 1 catalytic subunit gamma [ Homo sapiens (human) ]
• Official Symbol: PPP1CC
• Synonyms: PPP1CC; protein phosphatase 1, catalytic subunit, gamma isozyme; protein phosphatase 1, catalytic subunit, gamma isoform; serine/threonine-protein phosphatase PP1-gamma catalytic subunit; PP1gamma; serine/threonine phosphatase 1 gamma; protein phosphatase 1C catalytic subunit; PP-1G; PPP1G
• Gene ID: 5501
• mRNA Refseq: NM_002710
• Protein Refseq: NP_002701
• MIM: 176914
• UniProt ID: P36873