Recombinant Human PPP1CC protein, His&Myc-tagged

Cat.No. : PPP1CC-3367H
Product Overview : Recombinant Human PPP1CC protein(P36873)(2-323aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 2-323aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 44.3 kDa
AA Sequence : ADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name PPP1CC protein phosphatase 1, catalytic subunit, gamma isozyme [ Homo sapiens ]
Official Symbol PPP1CC
Synonyms PPP1CC; protein phosphatase 1, catalytic subunit, gamma isozyme; protein phosphatase 1, catalytic subunit, gamma isoform; serine/threonine-protein phosphatase PP1-gamma catalytic subunit; PP1gamma; serine/threonine phosphatase 1 gamma; protein phosphatase 1C catalytic subunit; PP-1G; PPP1G;
Gene ID 5501
mRNA Refseq NM_001244974
Protein Refseq NP_001231903
MIM 176914
UniProt ID P36873

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPP1CC Products

Required fields are marked with *

My Review for All PPP1CC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon