Recombinant Human PPP1CB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PPP1CB-5964H
• Product Overview: PPP1CB MS Standard C13 and N15-labeled recombinant protein (NP_996759) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.
• Molecular Mass: 37.2 kDa
• AA Sequence: MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PPP1CB protein phosphatase 1 catalytic subunit beta [ Homo sapiens (human) ]
• Official Symbol: PPP1CB
• Synonyms: PPP1CB; protein phosphatase 1, catalytic subunit, beta isozyme; protein phosphatase 1, catalytic subunit, beta isoform; serine/threonine-protein phosphatase PP1-beta catalytic subunit; PP 1B; PP1beta; protein phosphatase 1-beta; protein phosphatase 1-delta; protein phosphatase 1, catalytic subunit, delta isoform; serine/threonine protein phosphatase PP1-beta catalytic subunit; PP-1B; PPP1CD; MGC3672
• Gene ID: 5500
• mRNA Refseq: NM_206876
• Protein Refseq: NP_996759
• MIM: 600590
• UniProt ID: P62140