Recombinant Human PPM1K, His-tagged

Cat.No. : PPM1K-174H
Product Overview : Recombinant Human Protein Phosphatase 1K Mitochondrial/PPM1K is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Asp30-Ala372) of Human PPM1K fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 30-372 a.a.
Description : Protein Phosphatase 1K Mitochondrial (PPM1K) is a member of the PP2C family. PPM1K localizes to the cell mitochondrion matrix and contains one PP2C-like domain. PPM1K has metal ion binding and protein serine/threonine phosphatase activity. One subunit of PPM1K can bind one magnesium or manganese ion. PPM1K regulates the mitochondrial permeability transition pore and it is essential for cellular survival and development.
AA Sequence : DDRRVTPTCHSSTSEPRCSRFDPDGSGSPATWDNFGIWDNRIDEPILLPPSIKYGKPIPK61ISL EKVGCASQIGKRKENEDRFDFAQLTDEVLYFAVYDGHGGPAAADFCHTHMEKCIMDL121LPKEK NLETLLTLAFLEIDKAFSSHARLSADATLLTSGTTATVALLRDGIELVVASVGDS181RAILCRK GKPMKLTIDHTPERKDEKERIKKCGGFVAWNSLGQPHVNGRLAMTRSIGDLDL241KTSGVIAEP ETKRIKLHHADDSFLVLTTDGINFMVNSQEICDFVNQCHDPNEAAHAVTEQ31AIQYGTEDNST AVVVPFGAWGKYKNSEINFSFSRSFASSGRWAVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name PPM1K protein phosphatase, Mg2+/Mn2+ dependent, 1K [ Homo sapiens ]
Official Symbol PPM1K
Synonyms PPM1K; protein phosphatase, Mg2+/Mn2+ dependent, 1K; protein phosphatase 1K (PP2C domain containing); protein phosphatase 1K, mitochondrial; BDP; branched chain α ketoacid dehydrogenase phosphatase; DKFZp761G058; hPTMP; PP2C type mitochondrial phosphoprotein phosphatase; PP2Ckappa; PP2Cm; protein phosphatase 2C kappa; PP2C-kappa; PP2C-like protein; PP2C-like mitochondrial protein; PP2C type mitochondrial phosphatase; protein phosphatase 2C isoform kappa; PP2C domain-containing protein phosphatase 1K; PP2C-type mitochondrial phosphoprotein phosphatase; branched-chain & #945; -ketoacid dehydrogenase phosphatase; PTMP; UG0882E07; DKFZp667B084;
Gene ID 152926
mRNA Refseq NM_152542
Protein Refseq NP_689755
MIM 611065
UniProt ID Q8N3J5
Chromosome Location 4q22.1
Function hydrolase activity; metal ion binding; protein serine/threonine phosphatase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPM1K Products

Required fields are marked with *

My Review for All PPM1K Products

Required fields are marked with *

0

Inquiry Basket

cartIcon