Recombinant Human PPM1D protein, His-tagged

• Cat.No.: PPM1D-2917H
• Product Overview: Recombinant Human PPM1D protein(254-423 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 254-423 aa
• AA Sequence: NGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPQQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVKSLE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PPM1D protein phosphatase, Mg2+/Mn2+ dependent, 1D [ Homo sapiens ]
• Official Symbol: PPM1D
• Synonyms: PPM1D; protein phosphatase, Mg2+/Mn2+ dependent, 1D; protein phosphatase 1D magnesium dependent, delta isoform; protein phosphatase 1D; PP2C DELTA; protein phosphatase 2C; delta isoform; wild type p53 induced phosphatase 1; Wip1; protein phosphatase Wip1; wild-type p53-induced phosphatase 1; protein phosphatase 2C delta isoform; protein phosphatase magnesium-dependent 1 delta; protein phosphatase 1D magnesium-dependent, delta isoform; WIP1; PP2C-DELTA
• Gene ID: 8493
• mRNA Refseq: NM_003620
• Protein Refseq: NP_003611
• MIM: 605100
• UniProt ID: O15297