Recombinant Human PPARGLBD Protein, GST-tagged
Cat.No. : | PPARGLBD-325H |
Product Overview : | Recombinant Human PPARGLBD Protein (aa 201-477) is produced by baculovirus-infected insect cells expression system. This protein is fused with a GST tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | GST |
ProteinLength : | aa 201-477 |
Description : | Peroxisome proliferator-activated receptor gamma (PPAR-γ or PPARG) is also known as the glitazone receptor, or NR1C3 (nuclear receptor subfamily 1, group C, member 3). GST-tagged Peroxisome proliferator-activated receptor gamma ligand-binding domain (PPARG-LBD) consists of a 218 a.a. GST tag. PPARG-LBD was produced in the absence of detergents and exogenous ligands to ensure advanced performance in ligand-binding assays and coregulator displacement studies. |
Form : | 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.5 mM EDTA, 3 mM Dithiothreitol, 7 mM reduced glutathione, 20% glycerol. |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWENKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY |
Purity : | >90% |
Applications : | Ligand binding and coactivator peptide recruitment assays. |
Notes : | Avoid freeze-thaw cycles. While working, please keep sample on ice. |
Storage : | Immediately store at -80 centigrade. |
Gene Name | PPARG peroxisome proliferator-activated receptor gamma [ Homo sapiens ] |
Official Symbol | PPARG |
Synonyms | PPARG; NR1C3; PPARG1; PPARG2; PPARgamma; PPAR gamma; PPAR-gamma; GLM1; CIMT1; |
Gene ID | 5468 |
mRNA Refseq | NM_005037 |
Protein Refseq | NP_005028 |
MIM | 601487 |
UniProt ID | P37231 |
◆ Recombinant Proteins | ||
Ephb6-459M | Active Recombinant Mouse Eph Receptor B6, His-tagged | +Inquiry |
Gba-5408M | Recombinant Mouse Gba protein, His-tagged | +Inquiry |
RFL32522SF | Recombinant Full Length Saccharomyces Cerevisiae Er Membrane Protein Complex Subunit 3(Aim27) Protein, His-Tagged | +Inquiry |
EGFR-1226R | Recombinant Rhesus macaque EGFR protein, Fc-tagged | +Inquiry |
NDFIP1-2965R | Recombinant Rhesus monkey NDFIP1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Pectin-008A | Native Apple or Citrus fruits Pectin | +Inquiry |
FN1-28900TH | Native Human FN1 | +Inquiry |
ALB-37G | Native Goat Albumin (ALB) Protein | +Inquiry |
SULF2-02F | Active Native Flavobacterium heparinum 2-O-Sulfatase | +Inquiry |
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOSR1-5827HCL | Recombinant Human GOSR1 293 Cell Lysate | +Inquiry |
AKR1C3-49HCL | Recombinant Human AKR1C3 cell lysate | +Inquiry |
SM539-013WCY | Human CNS cancer SM539 Whole Cell Lysate | +Inquiry |
Lung-309H | Human Lung Diabetic Disease Lysate | +Inquiry |
EDDM3B-6725HCL | Recombinant Human EDDM3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPARGLBD Products
Required fields are marked with *
My Review for All PPARGLBD Products
Required fields are marked with *
0
Inquiry Basket