Recombinant Human POTEH protein, GST-tagged

• Cat.No.: POTEH-301256H
• Product Overview: Recombinant Human POTEH (24-59 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met24-Ser59
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MGKWCRHCFAWCRGSGKSNVGTSGDHDDSAMKTLRS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: POTEH POTE ankyrin domain family, member H [ Homo sapiens ]
• Official Symbol: POTEH
• Synonyms: POTEH; POTE ankyrin domain family, member H; A26C3, ACTBL1, actin, beta like 1 , ANKRD26 like family C, member 3; POTE ankyrin domain family member H; cancer/testis antigen family 104; member 7; CT104.7; POTE22; POTE-22; actin, beta-like 1; ANKRD26-like family C member 3; ANKRD26-like family C, member 3; cancer/testis antigen family 104, member 7; prostate, ovary, testis-expressed protein on chromosome 22; protein expressed in prostate, ovary, testis, and placenta 22; protein expressed in prostate, ovary, testis, and placenta POTE14 like; A26C3; ACTBL1
• Gene ID: 23784
• mRNA Refseq: NM_001136213
• Protein Refseq: NP_001129685
• MIM: 608913
• UniProt ID: Q6S545