Recombinant Human POTEH Protein, GST-tagged

Cat.No. : POTEH-213H
Product Overview : Human ACTBL1 partial ORF ( NP_001004053, 189 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : POTEH (POTE Ankyrin Domain Family Member H) is a Protein Coding gene. An important paralog of this gene is POTEM.
Molecular Mass : 36.74 kDa
AA Sequence : VPRKDLIVMLKDTDMNKKDKQKRTALHLASANGNSEVVKLLLDRRCQLNVLDNKKRTALTKAVQCQEDECALMLLEHGTDPNIPDEYGNTALHYAIYNED
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name POTEH POTE ankyrin domain family, member H [ Homo sapiens ]
Official Symbol POTEH
Synonyms POTEH; POTE ankyrin domain family, member H; A26C3, ACTBL1, actin, beta like 1 , ANKRD26 like family C, member 3; POTE ankyrin domain family member H; cancer/testis antigen family 104; member 7; CT104.7; POTE22; POTE-22; actin, beta-like 1; ANKRD26-like family C member 3; ANKRD26-like family C, member 3; cancer/testis antigen family 104, member 7; prostate, ovary, testis-expressed protein on chromosome 22; protein expressed in prostate, ovary, testis, and placenta 22; protein expressed in prostate, ovary, testis, and placenta POTE14 like; A26C3; ACTBL1;
Gene ID 23784
mRNA Refseq NM_001136213
Protein Refseq NP_001129685
MIM 608913
UniProt ID Q6S545

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All POTEH Products

Required fields are marked with *

My Review for All POTEH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon