Recombinant Human POTEH Protein, GST-tagged

• Cat.No.: POTEH-213H
• Product Overview: Human ACTBL1 partial ORF ( NP_001004053, 189 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: POTEH (POTE Ankyrin Domain Family Member H) is a Protein Coding gene. An important paralog of this gene is POTEM.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: VPRKDLIVMLKDTDMNKKDKQKRTALHLASANGNSEVVKLLLDRRCQLNVLDNKKRTALTKAVQCQEDECALMLLEHGTDPNIPDEYGNTALHYAIYNED
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: POTEH POTE ankyrin domain family, member H [ Homo sapiens ]
• Official Symbol: POTEH
• Synonyms: POTEH; POTE ankyrin domain family, member H; A26C3, ACTBL1, actin, beta like 1 , ANKRD26 like family C, member 3; POTE ankyrin domain family member H; cancer/testis antigen family 104; member 7; CT104.7; POTE22; POTE-22; actin, beta-like 1; ANKRD26-like family C member 3; ANKRD26-like family C, member 3; cancer/testis antigen family 104, member 7; prostate, ovary, testis-expressed protein on chromosome 22; protein expressed in prostate, ovary, testis, and placenta 22; protein expressed in prostate, ovary, testis, and placenta POTE14 like; A26C3; ACTBL1
• Gene ID: 23784
• mRNA Refseq: NM_001136213
• Protein Refseq: NP_001129685
• MIM: 608913
• UniProt ID: Q6S545