Recombinant Human POT1

• Cat.No.: POT1-27935TH
• Product Overview: Recombinant fragment corresponding to amino acids 1-95 of Human POT1 with a propreitary tag; predicted mwt: 36.08 kDa.

Specification

• Description: This gene is a member of the telombin family and encodes a nuclear protein involved in telomere maintenance. Specifically, this protein functions as a member of a multi-protein complex that binds to the TTAGGG repeats of telomeres, regulating telomere length and protecting chromosome ends from illegitimate recombination, catastrophic chromosome instability, and abnormal chromosome segregation. Increased transcriptional expression of this gene is associated with stomach carcinogenesis and its progression. Alternatively spliced transcript variants have been described.
• Protein length: 1-95 a.a.
• Molecular Weight: 36.080kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQG
• Sequence Similarities: Belongs to the telombin family.
• Tag: Non

Gene Information

• Gene Name: POT1 protection of telomeres 1 homolog (S. pombe) [ Homo sapiens ]
• Official Symbol: POT1
• Synonyms: POT1; protection of telomeres 1 homolog (S. pombe); protection of telomeres protein 1; DKFZp586D211; hPot1
• Gene ID: 25913
• mRNA Refseq: NM_001042594
• Protein Refseq: NP_001036059
• MIM: 606478
• Uniprot ID: Q9NUX5
• Chromosome Location: 7q31.33
• Pathway: Chromosome Maintenance, organism-specific biosystem; Meiosis, organism-specific biosystem; Meiotic Synapsis, organism-specific biosystem; Packaging Of Telomere Ends, organism-specific biosystem; Regulation of Telomerase, organism-specific biosystem
• Function: DEAD/H-box RNA helicase binding; DNA binding; protein binding; single-stranded telomeric DNA binding; single-stranded telomeric DNA binding