Recombinant Human POMGNT1, His-tagged

Cat.No. : POMGNT1-27934TH
Product Overview : Recombinant fragment, corresponding to amino acids 408-660 of Human POMGNT1 with N terminal His tag; 42 kDa ;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 408-660 a.a.
Description : The protein encoded by this gene is a type II transmembrane protein that resides in the golgi. It participates in O-mannosyl glycosylation, and is specific for alpha linked terminal mannose. Mutations in this gene are associated with muscle-eye-brain (MEB) disease. Alternatively spliced transcript variants have been found for this gene.
Conjugation : HIS
Tissue specificity : Constitutively expressed. An additional weaker band is also detected in spinal cord, lymph node, and trachea. Expressed especially in astrocytes. Also expressed in immature and mature neurons.
Form : Lyophilised:Reconstitute with 32 μl distilled water.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMP GLGWVLRRSLYKEELEPKWPTPEKLWDWDMWMRMPEQR RGRECIIPDVSRSYHFGIVGLNMNGYFHEAYFKKHKFN TVPGVQLRNVDSLKKEAYEVEVHRLLSEAEVLDHSKNP CEDSFLPDTEGHTYVAFIRMEKDDDFTTWTQLAKCLHIWD LDVRGNHRGLWRLFRKKNHFLVVGVPASPYSVKKPPSV TPIFLEPPPKEEGAPGAPEQT
Sequence Similarities : Belongs to the glycosyltransferase 13 family.
Gene Name POMGNT1 protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase [ Homo sapiens ]
Official Symbol POMGNT1
Synonyms POMGNT1; protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase; protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1; FLJ20277; MGAT1.2; protein O mannose beta 1; 2 N acetylglucosaminyltransferase;
Gene ID 55624
mRNA Refseq NM_001243766
Protein Refseq NP_001230695
MIM 606822
Uniprot ID Q8WZA1
Chromosome Location 1p34.1
Pathway Other types of O-glycan biosynthesis, organism-specific biosystem; Other types of O-glycan biosynthesis, conserved biosystem;
Function alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity; beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase activity; transferase activity, transferring glycosyl groups;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All POMGNT1 Products

Required fields are marked with *

My Review for All POMGNT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon