Recombinant Human POLRMT protein, His-tagged

Cat.No. : POLRMT-1853H
Product Overview : ecombinant Human POLRMT protein(NP_005026.3)(282-405 aa), fused to His-tag, was expressed in E.coli.
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a mitochondrial DNA-directed RNA polymerase. The gene product is responsible for mitochondrial gene expression as well as for providing RNA primers for initiation of replication of the mitochondrial genome. Although this polypeptide has the same function as the three nuclear DNA-directed RNA polymerases, it is more closely related to RNA polymerases of phage and mitochondrial polymerases of lower eukaryotes.
Source : E. coli
Species : Human
Tag : His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
Bio-activity : Not tested.
Protein length : 282-405 aa
AA Sequence : YVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLH
Endotoxin : Please contact the lab for more information.
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Applications : Blocking peptide
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name POLRMT RNA polymerase mitochondrial [ Homo sapiens (human) ]
Official Symbol POLRMT
Synonyms APOLMT; MTRNAP; MTRPOL; h-mtRPOL
Gene ID 5442
mRNA Refseq NM_005035.4
Protein Refseq NP_005026.3
MIM 601778
UniProt ID Q4G0F4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All POLRMT Products

Required fields are marked with *

My Review for All POLRMT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon