Recombinant Human POLRMT, His-tagged

Cat.No. : POLRMT-27748TH
Product Overview : Recombinant fragment, corresponding to amino acids 1051-1230 of Human mtRNA polymerase with an N-terminal His tag; MWt 21 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1051-1230 a.a.
Description : This gene encodes a mitochondrial DNA-directed RNA polymerase. The gene product is responsible for mitochondrial gene expression as well as for providing RNA primers for initiation of replication of the mitochondrial genome. Although this polypeptide has the same function as the three nuclear DNA-directed RNA polymerases, it is more closely related to RNA polymerases of phage and mitochondrial polymerases of lower eukaryotes.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 79 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QHWLTESARLISHMGSVVEWVTPLGVPVIQPYRLDSKVKQ IGGGIQSITYTHNGDISRKPNTRKQKNGFPPNFIHSLD SSHMMLTALHCYRKGLTFVSVHDCYWTHAADVSVMNQV CREQFVRLHSEPILQDLSRFLVKRFCSEPQKILEASQL KETLQAVPKPGAFDLEQVKRSTYFFS
Sequence Similarities : Belongs to the phage and mitochondrial RNA polymerase family.
Gene Name POLRMT polymerase (RNA) mitochondrial (DNA directed) [ Homo sapiens ]
Official Symbol POLRMT
Synonyms POLRMT; polymerase (RNA) mitochondrial (DNA directed); DNA-directed RNA polymerase, mitochondrial; APOLMT; h mtRPOL; MTRNAP; MTRPOL;
Gene ID 5442
mRNA Refseq NM_005035
Protein Refseq NP_005026
MIM 601778
Uniprot ID O00411
Chromosome Location 19p13.3
Pathway Mitochondrial Gene Expression, organism-specific biosystem; Mitochondrial transcription initiation, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem; Transcription, organism-specific biosystem; Transcription from mitochondrial promoters, organism-specific biosystem;
Function DNA binding; DNA-directed RNA polymerase activity; DNA-directed RNA polymerase activity; nucleotidyltransferase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All POLRMT Products

Required fields are marked with *

My Review for All POLRMT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon