Recombinant Human POLRMT, His-tagged
Cat.No. : | POLRMT-27748TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1051-1230 of Human mtRNA polymerase with an N-terminal His tag; MWt 21 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1051-1230 a.a. |
Description : | This gene encodes a mitochondrial DNA-directed RNA polymerase. The gene product is responsible for mitochondrial gene expression as well as for providing RNA primers for initiation of replication of the mitochondrial genome. Although this polypeptide has the same function as the three nuclear DNA-directed RNA polymerases, it is more closely related to RNA polymerases of phage and mitochondrial polymerases of lower eukaryotes. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 79 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QHWLTESARLISHMGSVVEWVTPLGVPVIQPYRLDSKVKQ IGGGIQSITYTHNGDISRKPNTRKQKNGFPPNFIHSLD SSHMMLTALHCYRKGLTFVSVHDCYWTHAADVSVMNQV CREQFVRLHSEPILQDLSRFLVKRFCSEPQKILEASQL KETLQAVPKPGAFDLEQVKRSTYFFS |
Sequence Similarities : | Belongs to the phage and mitochondrial RNA polymerase family. |
Gene Name | POLRMT polymerase (RNA) mitochondrial (DNA directed) [ Homo sapiens ] |
Official Symbol | POLRMT |
Synonyms | POLRMT; polymerase (RNA) mitochondrial (DNA directed); DNA-directed RNA polymerase, mitochondrial; APOLMT; h mtRPOL; MTRNAP; MTRPOL; |
Gene ID | 5442 |
mRNA Refseq | NM_005035 |
Protein Refseq | NP_005026 |
MIM | 601778 |
Uniprot ID | O00411 |
Chromosome Location | 19p13.3 |
Pathway | Mitochondrial Gene Expression, organism-specific biosystem; Mitochondrial transcription initiation, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem; Transcription, organism-specific biosystem; Transcription from mitochondrial promoters, organism-specific biosystem; |
Function | DNA binding; DNA-directed RNA polymerase activity; DNA-directed RNA polymerase activity; nucleotidyltransferase activity; protein binding; |
◆ Recombinant Proteins | ||
POLRMT-27748TH | Recombinant Human POLRMT, His-tagged | +Inquiry |
POLRMT-1853H | Recombinant Human POLRMT protein, His-tagged | +Inquiry |
POLRMT-1578H | Recombinant Human POLRMT protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLRMT-3019HCL | Recombinant Human POLRMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All POLRMT Products
Required fields are marked with *
My Review for All POLRMT Products
Required fields are marked with *
0
Inquiry Basket