Recombinant Human POLR2M, His-tagged

• Cat.No.: POLR2M-28539TH
• Product Overview: Recombinant fragment, corresponding to amino acids 32-211 of Human GRINL1A with N terminal His tag; 180 amino acids, 42kDa.

Specification

• Description: This gene encodes a subunit of RNA polymerase II, a protein complex that is responsible for synthesizing messenger RNA in eukaryotes. The encoded protein functions as a component of a specific form of RNA polymerase II termed Pol II(G). This protein may act as a negative regulator of activator-dependent transcription. Alternate splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring upstream gene MYZAP (myocardial zonula adherens protein).
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 87 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ERLLRNELQRITIADQGEQQSEENASTKNLTGLSSGTEKK PHYMEVLEMRAKNPVPQLRKFKTNVLPFRQNDSSSHCQ KSGSPISSEERRRRDKQHLDDITAARLLPLHHMPTQLL SIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYN PEGESSGRYREVRDEDDDWSSDEF
• Protein length: 32-211 a.a.

Gene Information

• Gene Name: POLR2M polymerase (RNA) II (DNA directed) polypeptide M [ Homo sapiens ]
• Official Symbol: POLR2M
• Synonyms: POLR2M; polymerase (RNA) II (DNA directed) polypeptide M; glutamate receptor, ionotropic, N methyl D aspartate like 1A , GRINL1A; protein GRINL1A; GCOM1; Gdown; Gdown1
• Gene ID: 81488
• mRNA Refseq: NM_001018102
• Protein Refseq: NP_001018112
• MIM: 606485
• Uniprot ID: P0CAP2
• Chromosome Location: 15q21.3
• Function: DNA-directed RNA polymerase activity