Recombinant Human POLR2E Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: POLR2E-2514H
• Product Overview: POLR2E MS Standard C13 and N15-labeled recombinant protein (NP_002686) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes the fifth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases and is present in two-fold molar excess over the other polymerase subunits. An interaction between this subunit and a hepatitis virus transactivating protein has been demonstrated, suggesting that interaction between transcriptional activators and the polymerase can occur through this subunit. A pseudogene is located on chromosome 11. Three transcript variants encoding two different isoforms have been found for this gene.
• Molecular Mass: 24.6 kDa
• AA Sequence: MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: POLR2E RNA polymerase II, I and III subunit E [ Homo sapiens (human) ]
• Official Symbol: POLR2E
• Synonyms: POLR2E; polymerase (RNA) II (DNA directed) polypeptide E, 25kDa; polymerase (RNA) II (DNA directed) polypeptide E (25kD); DNA-directed RNA polymerases I, II, and III subunit RPABC1; DNA directed RNA polymerase II 23 kda polypeptide; hRPB25; hsRPB5; RPABC1; RPB5; XAP4; RPB5 homolog; DNA-directed RNA polymerase II subunit E; RNA polymerases I, II, and III subunit ABC1; DNA-directed RNA polymerase II 23 kDa polypeptide
• Gene ID: 5434
• mRNA Refseq: NM_002695
• Protein Refseq: NP_002686
• MIM: 180664
• UniProt ID: P19388