Recombinant Human POLA1

• Cat.No.: POLA1-28359TH
• Product Overview: Recombinant fragment of Human DNA polymerase alpha (aa 1363-1462) with a N terminal proprietary tag: predicted molecular weight 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes the catalytic subunit of DNA polymerase, which together with a regulatory and two primase subunits, forms the DNA polymerase alpha complex. The catalytic subunit plays an essential role in the initiation of DNA replication.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS
• Sequence Similarities: Belongs to the DNA polymerase type-B family.

Gene Information

• Gene Name: POLA1 polymerase (DNA directed), alpha 1, catalytic subunit [ Homo sapiens ]
• Official Symbol: POLA1
• Synonyms: POLA1; polymerase (DNA directed), alpha 1, catalytic subunit; POLA, polymerase (DNA directed), alpha , polymerase (DNA directed), alpha 1; DNA polymerase alpha catalytic subunit; p180
• Gene ID: 5422
• mRNA Refseq: NM_016937
• Protein Refseq: NP_058633
• MIM: 312040
• Uniprot ID: P09884
• Chromosome Location: Xp22.1-p21.3
• Pathway: Activation of the pre-replicative complex, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; DNA Replication, organism-specific biosystem; DNA Replication, organism-specific biosystem
• Function: DNA binding; DNA binding; contributes_to DNA primase activity; DNA-directed DNA polymerase activity; DNA-directed DNA polymerase activity