Recombinant Human POFUT1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: POFUT1-5152H
• Product Overview: POFUT1 MS Standard C13 and N15-labeled recombinant protein (NP_056167) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 43.96 kDa
• AA Sequence: MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQKYMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTMTMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHFIGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: POFUT1 protein O-fucosyltransferase 1 [ Homo sapiens (human) ]
• Official Symbol: POFUT1
• Synonyms: POFUT1; protein O-fucosyltransferase 1; GDP-fucose protein O-fucosyltransferase 1; FUT12; KIAA0180; O Fuc T; O FUT; o-fucosyltransferase protein; peptide-O-fucosyltransferase 1; O-FUT; O-Fuc-T; O-FucT-1; MGC2482
• Gene ID: 23509
• mRNA Refseq: NM_015352
• Protein Refseq: NP_056167
• MIM: 607491
• UniProt ID: Q9H488