Recombinant Human PNPLA3 protein, GST-tagged
| Cat.No. : | PNPLA3-1819H |
| Product Overview : | Recombinant Human PNPLA3(229-339aa) protein was fused to GST-tag and expressed in E.coli. |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Description : | The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes. |
| Source : | E.coli |
| Species : | Human |
| Tag : | GST |
| Form : | Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5% trehalose and 5% mannitol are added as protectants before lyophilization. |
| Molecular Mass : | 38 kDa |
| Protein length : | 111 |
| AA Sequence : | PDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYM |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Buffer containing 50% glycerol is recommended for reconstitution. |
| Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
| Gene Name | PNPLA3 |
| Official Symbol | PNPLA3 |
| Synonyms | ADPN; C22orf20; iPLA(2)epsilon |
| Gene ID | 80339 |
| mRNA Refseq | NM_025225.3 |
| Protein Refseq | NP_079501.2 |
| MIM | 609567 |
| UniProt ID | Q9NST1 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PNPLA3 Products
Required fields are marked with *
My Review for All PNPLA3 Products
Required fields are marked with *
0
Inquiry Basket
