Recombinant Human PMEL Protein, GST-tagged

• Cat.No.: PMEL-191H
• Product Overview: Human SILV full-length ORF ( NP_008859.1, 1 a.a. - 661 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Molecular Mass: 96.7 kDa
• AA Sequence: MDLVLKRCLLHLAVIGALLAVGATKVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLDCWRGGQVSLKVSNDGPTLIGANASFSIALNFPGSQKVLPDGQVIWVNNTIINGSQVWGGQPVYPQETDDACIFPDGGPCPSGSWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTHTMEVTVYHRRGSRSYVPLAHSSSAFTITDQVPFSVSVSQLRALDGGNKHFLRNQPLTFALQLHDPSGYLAEAD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PMEL premelanosome protein [ Homo sapiens (human) ]
• Official Symbol: PMEL
• Synonyms: PMEL; premelanosome protein; P1; SI; SIL; ME20; P100; SILV; ME20M; gp100; ME20-M; PMEL17; D12S53E; melanocyte protein PMEL; melanocyte protein Pmel 17; melanocyte protein mel 17; melanocytes lineage-specific antigen GP100; melanoma-associated ME20 antigen; melanosomal matrix protein17; silver locus protein homolog; silver, mouse, homolog of
• Gene ID: 6490
• mRNA Refseq: NM_006928
• Protein Refseq: NP_008859
• MIM: 155550
• UniProt ID: P40967