Recombinant Full Length Human PMEL Protein, GST-tagged
Cat.No. : | PMEL-6849HF |
Product Overview : | Human SILV full-length ORF ( NP_008859.1, 1 a.a. - 661 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 661 amino acids |
Description : | This gene encodes a melanocyte-specific type I transmembrane glycoprotein. The encoded protein is enriched in melanosomes, which are the melanin-producing organelles in melanocytes, and plays an essential role in the structural organization of premelanosomes. This protein is involved in generating internal matrix fibers that define the transition from Stage I to Stage II melanosomes. This protein undergoes a complex pattern of prosttranslational processing and modification that is essential to the proper functioning of the protein. A secreted form of this protein that is released by proteolytic ectodomain shedding may be used as a melanoma-specific serum marker. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 96.7 kDa |
AA Sequence : | MDLVLKRCLLHLAVIGALLAVGATKVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLDCWRGGQVSLKVSNDGPTLIGANASFSIALNFPGSQKVLPDGQVIWVNNTIINGSQVWGGQPVYPQETDDACIFPDGGPCPSGSWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTHTMEVTVYHRRGSRSYVPLAHSSSAFTITDQVPFSVSVSQLRALDGGNKHFLRNQPLTFALQLHDPSGYLAEAD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PMEL premelanosome protein [ Homo sapiens (human) ] |
Official Symbol | PMEL |
Synonyms | PMEL; premelanosome protein; P1; SI; SIL; ME20; P100; SILV; ME20M; gp100; ME20-M; PMEL17; D12S53E; melanocyte protein PMEL; melanocyte protein Pmel 17; melanocyte protein mel 17; melanocytes lineage-specific antigen GP100; melanoma-associated ME20 antigen; melanosomal matrix protein17; silver locus protein homolog; silver, mouse, homolog of |
Gene ID | 6490 |
mRNA Refseq | NM_006928 |
Protein Refseq | NP_008859 |
MIM | 155550 |
UniProt ID | P40967 |
◆ Recombinant Proteins | ||
PMEL-6669C | Recombinant Chicken PMEL | +Inquiry |
PMEL-835HFL | Recombinant Full Length Human PMEL Protein, C-Flag-tagged | +Inquiry |
PMEL-191H | Recombinant Human PMEL Protein, GST-tagged | +Inquiry |
PMEL-190H | Recombinant Human PMEL protein, MYC/DDK-tagged | +Inquiry |
PMEL-1717H | Recombinant Human PMEL Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PMEL Products
Required fields are marked with *
My Review for All PMEL Products
Required fields are marked with *
0
Inquiry Basket