Recombinant Human PMEL protein(371-440 aa), C-His-tagged
Cat.No. : | PMEL-2756H |
Product Overview : | Recombinant Human PMEL protein(P40967)(371-440 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 371-440 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | STGMTPEKVPVSEVMGTTLAEMSTPEATGMTPAEVSIVVLSGTTAAQVTTTEWVETTARELPIPEPEGPD |
Gene Name | PMEL premelanosome protein [ Homo sapiens ] |
Official Symbol | PMEL |
Synonyms | PMEL; premelanosome protein; SIL, SILV, silver (mouse homolog) like , silver homolog (mouse); melanocyte protein PMEL; D12S53E; gp100; Pmel17; SI; melanocyte protein mel 17; silver, mouse, homolog of; melanocyte protein Pmel 17; melanosomal matrix protein17; silver locus protein homolog; melanoma-associated ME20 antigen; melanocytes lineage-specific antigen GP100; P1; SIL; ME20; P100; SILV; ME20M; ME20-M; PMEL17; |
Gene ID | 6490 |
mRNA Refseq | NM_001200053 |
Protein Refseq | NP_001186982 |
MIM | 155550 |
UniProt ID | P40967 |
◆ Recombinant Proteins | ||
PMEL-3492H | Recombinant Human PMEL protein, His-SUMO-tagged | +Inquiry |
PMEL-190H | Recombinant Human PMEL protein, MYC/DDK-tagged | +Inquiry |
PMEL-6669C | Recombinant Chicken PMEL | +Inquiry |
PMEL-6849HF | Recombinant Full Length Human PMEL Protein, GST-tagged | +Inquiry |
PMEL-1518H | Recombinant Human PMEL Protein (25-467 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PMEL Products
Required fields are marked with *
My Review for All PMEL Products
Required fields are marked with *
0
Inquiry Basket