Recombinant Human PMEL protein(371-440 aa), C-His-tagged

Cat.No. : PMEL-2756H
Product Overview : Recombinant Human PMEL protein(P40967)(371-440 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 371-440 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : STGMTPEKVPVSEVMGTTLAEMSTPEATGMTPAEVSIVVLSGTTAAQVTTTEWVETTARELPIPEPEGPD
Gene Name PMEL premelanosome protein [ Homo sapiens ]
Official Symbol PMEL
Synonyms PMEL; premelanosome protein; SIL, SILV, silver (mouse homolog) like , silver homolog (mouse); melanocyte protein PMEL; D12S53E; gp100; Pmel17; SI; melanocyte protein mel 17; silver, mouse, homolog of; melanocyte protein Pmel 17; melanosomal matrix protein17; silver locus protein homolog; melanoma-associated ME20 antigen; melanocytes lineage-specific antigen GP100; P1; SIL; ME20; P100; SILV; ME20M; ME20-M; PMEL17;
Gene ID 6490
mRNA Refseq NM_001200053
Protein Refseq NP_001186982
MIM 155550
UniProt ID P40967

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PMEL Products

Required fields are marked with *

My Review for All PMEL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon