Recombinant Human PMEL protein(371-440 aa), C-His-tagged

• Cat.No.: PMEL-2756H
• Product Overview: Recombinant Human PMEL protein(P40967)(371-440 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 371-440 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: STGMTPEKVPVSEVMGTTLAEMSTPEATGMTPAEVSIVVLSGTTAAQVTTTEWVETTARELPIPEPEGPD

Gene Information

• Gene Name: PMEL premelanosome protein [ Homo sapiens ]
• Official Symbol: PMEL
• Synonyms: PMEL; premelanosome protein; SIL, SILV, silver (mouse homolog) like , silver homolog (mouse); melanocyte protein PMEL; D12S53E; gp100; Pmel17; SI; melanocyte protein mel 17; silver, mouse, homolog of; melanocyte protein Pmel 17; melanosomal matrix protein17; silver locus protein homolog; melanoma-associated ME20 antigen; melanocytes lineage-specific antigen GP100; P1; SIL; ME20; P100; SILV; ME20M; ME20-M; PMEL17
• Gene ID: 6490
• mRNA Refseq: NM_001200053
• Protein Refseq: NP_001186982
• MIM: 155550
• UniProt ID: P40967