Recombinant Human PLP1 Full Length Transmembrane protein (2-277 aa), His-tagged
Cat.No. : | PLP1-2728H |
Product Overview : | Recombinant Human PLP1 Protein (2-277 aa) is produced by in vitro E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-277aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.5 kDa |
AA Sequence : | GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PLP1 proteolipid protein 1 [ Homo sapiens ] |
Official Symbol | PLP1 |
Synonyms | PLP1; proteolipid protein 1; PLP, spastic paraplegia 2, uncomplicated , SPG2; myelin proteolipid protein; Pelizaeus Merzbacher disease; lipophilin; major myelin proteolipid protein; PLP; PMD; HLD1; MMPL; SPG2; PLP/DM20; |
Gene ID | 5354 |
mRNA Refseq | NM_000533 |
Protein Refseq | NP_000524 |
MIM | 300401 |
UniProt ID | P60201 |
◆ Recombinant Proteins | ||
RFL34498GF | Recombinant Full Length Chicken Myelin Proteolipid Protein(Plp1) Protein, His-Tagged | +Inquiry |
PLP1-12987M | Recombinant Mouse PLP1 Protein | +Inquiry |
PLP1-2728H | Recombinant Human PLP1 Full Length Transmembrane protein (2-277 aa), His-tagged | +Inquiry |
PLP1-4531R | Recombinant Rat PLP1 Protein | +Inquiry |
PLP1-4191R | Recombinant Rat PLP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLP1-3099HCL | Recombinant Human PLP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLP1 Products
Required fields are marked with *
My Review for All PLP1 Products
Required fields are marked with *
0
Inquiry Basket