Recombinant Human PlGF-3 Protein
Cat.No. : | PGF-226H |
Product Overview : | Recombinant Human PlGF-3 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family and promotes endothelial cell growth and angiogenesis. PlGF is secreted as a homodimer and may also form a heterodimer with VEGF. PlGF is detected in the placenta, heart, lungs, thyroid, and adipose tissues. Circulating PlGF levels are correlated with colorectal and renal cancers, as well as atherosclerosis and ischemic heart disease. There are four alternatively spliced PlGF isoforms (PlGF-1, PlGF-2, PlGF-3, and PlGF-4), each with unique secretion patterns and heparin-binding affinities. PlGF-3 lacks a heparin-binding domain and signals through the VEGFR-1 receptor. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Dimer, 22.9/45.8 kDa (with 204/408 amino acids) |
AA Sequence : | MLPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL (50% confidence) |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | PGF placental growth factor [ Homo sapiens (human) ] |
Official Symbol | PGF |
Synonyms | PGF; placental growth factor; PGFL, placental growth factor, vascular endothelial growth factor related protein , placental growth factor like; placenta growth factor; D12S1900; PlGF; PLGF; PlGF 2; SHGC 10760; placental growth factor-like; placental growth factor, vascular endothelial growth factor-related protein; PGFL; PlGF-2; SHGC-10760; |
Gene ID | 5228 |
mRNA Refseq | NM_001207012 |
Protein Refseq | NP_001193941 |
MIM | 601121 |
UniProt ID | P49763 |
◆ Recombinant Proteins | ||
PGF-27H | Recombinant Human PGF, StrepII-tagged | +Inquiry |
PGF-484M | Recombinant Mouse Pgf, DDDDK tagged | +Inquiry |
PGF-30907TH | Recombinant Human PGF | +Inquiry |
Pgf-6053MFL | Recombinant Full Length Mouse Pgf, Flag-tagged | +Inquiry |
PGF-1036M | Recombinant Mouse PGF protein(Met1-Pro158) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGF-1118MCL | Recombinant Mouse PGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGF Products
Required fields are marked with *
My Review for All PGF Products
Required fields are marked with *
0
Inquiry Basket