Recombinant Human plexin A2 Protein, GST-tagged
Cat.No. : | PLXNA2-22H |
Product Overview : | Recombinant Human PLXNA2 Protein (1743-1894aa) with N-GST-tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | GST |
Protein Length : | 1743-1894aa |
Description : | This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C. |
Tag : | N-GST |
Molecular Mass : | 44 kDa |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKMHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.07 mg/mL by BCA |
Storage Buffer : | Sterile 20mM Tris, 1M NaCl, pH 8.0 |
Gene Name | PLXNA2 plexin A2 [Homo sapiens (human)] |
Official Symbol | PLXNA2 |
Synonyms | PLXNA2; plexin A2; PLXN2; plexin-A2; FLJ11751; FLJ30634; KIAA0463; OCT; plexin 2; semaphorin receptor OCT; transmembrane protein OCT |
Gene ID | 5362 |
mRNA Refseq | NM_025179 |
Protein Refseq | NP_079455 |
MIM | 601054 |
UniProt ID | O75051 |
◆ Recombinant Proteins | ||
PLXNA2-12999M | Recombinant Mouse PLXNA2 Protein | +Inquiry |
PLXNA2-6865M | Recombinant Mouse PLXNA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Plxna2-441M | Active Recombinant Mouse Plxna2, His-tagged | +Inquiry |
PLXNA2-23H | Recombinant Human plexin A2 Protein, GST-tagged | +Inquiry |
PLXNA2-21H | Recombinant Human PLXNA2 protein(Thr861- Val1220), SUMO &His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLXNA2 Products
Required fields are marked with *
My Review for All PLXNA2 Products
Required fields are marked with *
0
Inquiry Basket