Recombinant Human plexin A2 Protein, GST-tagged

• Cat.No.: PLXNA2-22H
• Product Overview: Recombinant Human PLXNA2 Protein (1743-1894aa) with N-GST-tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: GST
• ProteinLength: 1743-1894aa
• Description: This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C.
• Tag: N-GST
• Molecular Mass: 44 kDa
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKMHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.07 mg/mL by BCA
• Storage Buffer: Sterile 20mM Tris, 1M NaCl, pH 8.0

Gene Information

• Gene Name: PLXNA2 plexin A2 [Homo sapiens (human)]
• Official Symbol: PLXNA2
• Synonyms: PLXNA2; plexin A2; PLXN2; plexin-A2; FLJ11751; FLJ30634; KIAA0463; OCT; plexin 2; semaphorin receptor OCT; transmembrane protein OCT
• Gene ID: 5362
• mRNA Refseq: NM_025179
• Protein Refseq: NP_079455
• MIM: 601054
• UniProt ID: O75051